PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G223600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family CO-like
Protein Properties Length: 319aa    MW: 33523.8 Da    PI: 6.0998
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G223600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.11.2e-053277342
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                         ++C+ +e  +    C+ +   lC+ C    H+       H +vp+
  Brast07G223600.1.p 32 VWVCEVCEASPGAVACKADAAVLCAGCDADVHRAnplaqrHVRVPV 77
                        689******99*********************76888888888875 PP

2CCT705.9e-24243286144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea+l+RY+eKrk+R+FeK+irY+sRKa+AesRpRvKGrF+k++
  Brast07G223600.1.p 243 REARLTRYREKRKNRRFEKTIRYASRKAYAESRPRVKGRFAKRN 286
                         9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.673077IPR000315B-box-type zinc finger
SMARTSM003362.2E-103077IPR000315B-box-type zinc finger
CDDcd000214.84E-63377No hitNo description
PROSITE profilePS5101716.847243285IPR010402CCT domain
PfamPF062037.9E-18243285IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MMEYWGVGGR RCGALCDEAA PEHAGRLGHE RVWVCEVCEA SPGAVACKAD AAVLCAGCDA  60
DVHRANPLAQ RHVRVPVAPM SRVFFHGNGE ALRAPELEEE ALMINLNVEA GKLGGDEVKL  120
DLLFSDLVDG PYDLGCGAGF AARLNGHADS CLVPSAVDFA CGVGAAKPPP PNYGSCTANS  180
LAHSAGSSSE AGVVPEAACI CGSFELDLTR TIPQPYMPMP CAAAPPPPSH SVSSAAAAAG  240
EEREARLTRY REKRKNRRFE KTIRYASRKA YAESRPRVKG RFAKRNSSPG AGAGDDDDNE  300
AAVPSYMLDF GYGVVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560384.21e-132PREDICTED: zinc finger protein CONSTANS-LIKE 3
TrEMBLA0A0Q3RVA01e-132A0A0Q3RVA0_BRADI; Uncharacterized protein
STRINGBRADI1G31280.11e-124(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.15e-43CONSTANS-like 2